PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G407100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 216aa    MW: 24841.5 Da    PI: 5.2169
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G407100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32e-19956148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT+eEd++l+++++ +G + Wk++a + g++R++k+c++rw++yl
  Aqcoe5G407100.1.p  9 KGTWTAEEDQRLAEYIEIHGAKKWKSVAVKAGLNRCEKSCRLRWLNYL 56
                       799*******************************************97 PP

2Myb_DNA-binding54.42.9e-1762107148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg +T +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Aqcoe5G407100.1.p  62 RGHFTDQEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNDIKNYWNSHL 107
                        899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.731156IPR017930Myb domain
SMARTSM007172.9E-15858IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-298103IPR009057Homeodomain-like
PfamPF002499.8E-18956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241063IPR009057Homeodomain-like
CDDcd001676.87E-111156No hitNo description
PROSITE profilePS5129426.72857111IPR017930Myb domain
SMARTSM007175.6E-1661109IPR001005SANT/Myb domain
PfamPF002497.0E-1662107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2664112IPR009057Homeodomain-like
CDDcd001676.13E-1165107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MDTKRLVNKG TWTAEEDQRL AEYIEIHGAK KWKSVAVKAG LNRCEKSCRL RWLNYLRPNI  60
KRGHFTDQEE DLIIRLHKLL GNRWSLIAGR IPGRTDNDIK NYWNSHLSKK LKQEKLRNSV  120
IQEQSEITTG SVEEPESEIT TDHVEVNAER NSKGSDDNIN TSFNVDEFFN FSNEGSSNLE  180
WVSKFLEVDD GTDGFHENGN APFFGECDEL SLFYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-29711125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356551.12e-85PREDICTED: transcription repressor MYB5-like
SwissprotQ388502e-53MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A061GB733e-82A0A061GB73_THECC; Myb domain protein 5
TrEMBLA0A061GJK09e-83A0A061GJK0_THECC; Myb domain protein 23
STRINGVIT_09s0002g01380.t011e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-54myb domain protein 5